TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)
  • TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027095-B01P
TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRAPPC3 protein.
Información adicional
Size 50 ug
Gene Name TRAPPC3
Gene Alias BET3
Gene Description trafficking protein particle complex 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAPPC3 (NP_055223.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27095

Enviar un mensaje


TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)