FOXP1 polyclonal antibody (A01)
  • FOXP1 polyclonal antibody (A01)

FOXP1 polyclonal antibody (A01)

Ref: AB-H00027086-A01
FOXP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant FOXP1.
Información adicional
Size 50 uL
Gene Name FOXP1
Gene Alias 12CC4|FLJ23741|HSPC215|MGC12942|MGC88572|MGC99551|QRF1|hFKH1B
Gene Description forkhead box P1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FOXP1 (AAH05055, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27086

Enviar un mensaje


FOXP1 polyclonal antibody (A01)

FOXP1 polyclonal antibody (A01)