RPUSD2 MaxPab mouse polyclonal antibody (B01P)
  • RPUSD2 MaxPab mouse polyclonal antibody (B01P)

RPUSD2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027079-B01P
RPUSD2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RPUSD2 protein.
Información adicional
Size 50 ug
Gene Name RPUSD2
Gene Alias C15orf19|C18B11|FLJ31409
Gene Description RNA pseudouridylate synthase domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWLDRRGWLRVLGHWRYDLRRPSFTRTWSGDKGPMAETVSTQVGTEGGLRASHQQNGDAGGDAKVELSPGPPKPAGREVEPAPVGGEHPSAAAPGPGKHKKRRGATRERVVPPPKKRRTGVSFGDEHFAETSYYFEGGLRKVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPLAYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRHNTVI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPUSD2 (NP_689473, 1 a.a. ~ 545 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27079

Enviar un mensaje


RPUSD2 MaxPab mouse polyclonal antibody (B01P)

RPUSD2 MaxPab mouse polyclonal antibody (B01P)