Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
VPS41 polyclonal antibody (A01)
Abnova
VPS41 polyclonal antibody (A01)
Ref: AB-H00027072-A01
VPS41 polyclonal antibody (A01)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant VPS41.
Información adicional
Size
50 uL
Gene Name
VPS41
Gene Alias
HVPS41|HVSP41|hVps41p
Gene Description
vacuolar protein sorting 41 homolog (S. cerevisiae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
LLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEMK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VPS41 (NP_055211, 755 a.a. ~ 853 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
27072
Enviar un mensaje
VPS41 polyclonal antibody (A01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*