DAPP1 monoclonal antibody (M04), clone 1E1
  • DAPP1 monoclonal antibody (M04), clone 1E1

DAPP1 monoclonal antibody (M04), clone 1E1

Ref: AB-H00027071-M04
DAPP1 monoclonal antibody (M04), clone 1E1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DAPP1.
Información adicional
Size 100 ug
Gene Name DAPP1
Gene Alias BAM32|DKFZp667E0716
Gene Description dual adaptor of phosphotyrosine and 3-phosphoinositides
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAPP1 (AAH12924, 1 a.a. ~ 280 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27071
Clone Number 1E1
Iso type IgG2a Kappa

Enviar un mensaje


DAPP1 monoclonal antibody (M04), clone 1E1

DAPP1 monoclonal antibody (M04), clone 1E1