DAPP1 polyclonal antibody (A01)
  • DAPP1 polyclonal antibody (A01)

DAPP1 polyclonal antibody (A01)

Ref: AB-H00027071-A01
DAPP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DAPP1.
Información adicional
Size 50 uL
Gene Name DAPP1
Gene Alias BAM32|DKFZp667E0716
Gene Description dual adaptor of phosphotyrosine and 3-phosphoinositides
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAPP1 (NP_055210, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27071

Enviar un mensaje


DAPP1 polyclonal antibody (A01)

DAPP1 polyclonal antibody (A01)