STAU2 purified MaxPab rabbit polyclonal antibody (D01P)
  • STAU2 purified MaxPab rabbit polyclonal antibody (D01P)

STAU2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027067-D01P
STAU2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STAU2 protein.
Información adicional
Size 100 ug
Gene Name STAU2
Gene Alias 39K2|39K3|DKFZp781K0371|MGC119606
Gene Description staufen, RNA binding protein, homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDMDDDKDANKSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAU2 (NP_055208.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27067

Enviar un mensaje


STAU2 purified MaxPab rabbit polyclonal antibody (D01P)

STAU2 purified MaxPab rabbit polyclonal antibody (D01P)