PELP1 monoclonal antibody (M07), clone 4F7
  • PELP1 monoclonal antibody (M07), clone 4F7

PELP1 monoclonal antibody (M07), clone 4F7

Ref: AB-H00027043-M07
PELP1 monoclonal antibody (M07), clone 4F7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PELP1.
Información adicional
Size 100 ug
Gene Name PELP1
Gene Alias HMX3|MNAR|P160
Gene Description proline, glutamate and leucine rich protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27043
Clone Number 4F7
Iso type IgG2a Kappa

Enviar un mensaje


PELP1 monoclonal antibody (M07), clone 4F7

PELP1 monoclonal antibody (M07), clone 4F7