LAT polyclonal antibody (A01)
  • LAT polyclonal antibody (A01)

LAT polyclonal antibody (A01)

Ref: AB-H00027040-A01
LAT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant LAT.
Información adicional
Size 50 uL
Gene Name LAT
Gene Alias LAT1|pp36
Gene Description linker for activation of T cells
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LAT (AAH11563, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27040

Enviar un mensaje


LAT polyclonal antibody (A01)

LAT polyclonal antibody (A01)