SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)
  • SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)

SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027036-B01P
SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIGLEC7 protein.
Información adicional
Size 50 ug
Gene Name SIGLEC7
Gene Alias AIRM1|CD328|CDw328|D-siglec|QA79|SIGLEC-7|p75|p75/AIRM1
Gene Description sialic acid binding Ig-like lectin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIGLEC7 (NP_055200.1, 1 a.a. ~ 467 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27036

Enviar un mensaje


SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)

SIGLEC7 purified MaxPab mouse polyclonal antibody (B01P)