ACAD8 MaxPab rabbit polyclonal antibody (D01)
  • ACAD8 MaxPab rabbit polyclonal antibody (D01)

ACAD8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00027034-D01
ACAD8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACAD8 protein.
Información adicional
Size 100 uL
Gene Name ACAD8
Gene Alias ACAD-8|FLJ22590
Gene Description acyl-Coenzyme A dehydrogenase family, member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACAD8 (AAH01964.1, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 27034

Enviar un mensaje


ACAD8 MaxPab rabbit polyclonal antibody (D01)

ACAD8 MaxPab rabbit polyclonal antibody (D01)