Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACAD8 MaxPab rabbit polyclonal antibody (D01)
Abnova
ACAD8 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00027034-D01
ACAD8 MaxPab rabbit polyclonal antibody (D01)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human ACAD8 protein.
Información adicional
Size
100 uL
Gene Name
ACAD8
Gene Alias
ACAD-8|FLJ22590
Gene Description
acyl-Coenzyme A dehydrogenase family, member 8
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IP
Immunogen Prot. Seq
MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPV
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ACAD8 (AAH01964.1, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
27034
Enviar un mensaje
ACAD8 MaxPab rabbit polyclonal antibody (D01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*