ACAD8 polyclonal antibody (A01)
  • ACAD8 polyclonal antibody (A01)

ACAD8 polyclonal antibody (A01)

Ref: AB-H00027034-A01
ACAD8 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACAD8.
Información adicional
Size 50 uL
Gene Name ACAD8
Gene Alias ACAD-8|FLJ22590
Gene Description acyl-Coenzyme A dehydrogenase family, member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACAD8 (NP_055199, 306 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27034

Enviar un mensaje


ACAD8 polyclonal antibody (A01)

ACAD8 polyclonal antibody (A01)