DNAI1 MaxPab mouse polyclonal antibody (B01)
  • DNAI1 MaxPab mouse polyclonal antibody (B01)

DNAI1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00027019-B01
DNAI1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human DNAI1 protein.
Información adicional
Size 50 uL
Gene Name DNAI1
Gene Alias CILD1|ICS|ICS1|MGC26204|PCD
Gene Description dynein, axonemal, intermediate chain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAI1 (NP_036276.1, 1 a.a. ~ 699 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 27019

Enviar un mensaje


DNAI1 MaxPab mouse polyclonal antibody (B01)

DNAI1 MaxPab mouse polyclonal antibody (B01)