Ver mas grande
NGFRAP1 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00027018-B01P
Producto nuevo
NGFRAP1 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | NGFRAP1 |
| Gene Alias | BEX3|Bex|DXS6984E|HGR74|NADE |
| Gene Description | nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | NGFRAP1 (NP_996800.1, 1 a.a. ~ 101 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 27018 |
Más información
Mouse polyclonal antibody raised against a full-length human NGFRAP1 protein.