CYFIP2 monoclonal antibody (M01), clone 4G6
  • CYFIP2 monoclonal antibody (M01), clone 4G6

CYFIP2 monoclonal antibody (M01), clone 4G6

Ref: AB-H00026999-M01
CYFIP2 monoclonal antibody (M01), clone 4G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CYFIP2.
Información adicional
Size 100 ug
Gene Name CYFIP2
Gene Alias PIR121
Gene Description cytoplasmic FMR1 interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26999
Clone Number 4G6
Iso type IgG2a Kappa

Enviar un mensaje


CYFIP2 monoclonal antibody (M01), clone 4G6

CYFIP2 monoclonal antibody (M01), clone 4G6