CYFIP2 polyclonal antibody (A01)
  • CYFIP2 polyclonal antibody (A01)

CYFIP2 polyclonal antibody (A01)

Ref: AB-H00026999-A01
CYFIP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CYFIP2.
Información adicional
Size 50 uL
Gene Name CYFIP2
Gene Alias PIR121
Gene Description cytoplasmic FMR1 interacting protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CYFIP2 (NP_055191, 733 a.a. ~ 820 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26999

Enviar un mensaje


CYFIP2 polyclonal antibody (A01)

CYFIP2 polyclonal antibody (A01)