TRUB2 purified MaxPab mouse polyclonal antibody (B01P)
  • TRUB2 purified MaxPab mouse polyclonal antibody (B01P)

TRUB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026995-B01P
TRUB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRUB2 protein.
Información adicional
Size 50 ug
Gene Name TRUB2
Gene Alias CLONE24922|RP11-339B21.1
Gene Description TruB pseudouridine (psi) synthase homolog 2 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRUB2 (NP_056494.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26995

Enviar un mensaje


TRUB2 purified MaxPab mouse polyclonal antibody (B01P)

TRUB2 purified MaxPab mouse polyclonal antibody (B01P)