Ver mas grande
TRUB2 MaxPab mouse polyclonal antibody (B01)
AB-H00026995-B01
Producto nuevo
TRUB2 MaxPab mouse polyclonal antibody (B01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | TRUB2 |
| Gene Alias | CLONE24922|RP11-339B21.1 |
| Gene Description | TruB pseudouridine (psi) synthase homolog 2 (E. coli) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQV |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | TRUB2 (NP_056494.1, 1 a.a. ~ 331 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 26995 |
Más información
Mouse polyclonal antibody raised against a full-length human TRUB2 protein.