RNF11 polyclonal antibody (A01)
  • RNF11 polyclonal antibody (A01)

RNF11 polyclonal antibody (A01)

Ref: AB-H00026994-A01
RNF11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF11.
Información adicional
Size 50 uL
Gene Name RNF11
Gene Alias CGI-123|MGC51169|SID1669
Gene Description ring finger protein 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF11 (NP_055187, 65 a.a. ~ 154 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26994

Enviar un mensaje


RNF11 polyclonal antibody (A01)

RNF11 polyclonal antibody (A01)