COPG2 polyclonal antibody (A01)
  • COPG2 polyclonal antibody (A01)

COPG2 polyclonal antibody (A01)

Ref: AB-H00026958-A01
COPG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COPG2.
Información adicional
Size 50 uL
Gene Name COPG2
Gene Alias 2-COP|DKFZp761N09121|FLJ11781
Gene Description coatomer protein complex, subunit gamma 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HMMKISYDVVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLLKETEDGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPG2 (NP_036265, 165 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26958

Enviar un mensaje


COPG2 polyclonal antibody (A01)

COPG2 polyclonal antibody (A01)