STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)

STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00026872-D01P
STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STEAP1 protein.
Información adicional
Size 100 ug
Gene Name STEAP1
Gene Alias MGC19484|PRSS24|STEAP
Gene Description six transmembrane epithelial antigen of the prostate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STEAP1 (NP_036581.1, 1 a.a. ~ 339 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26872

Enviar un mensaje


STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)

STEAP1 purified MaxPab rabbit polyclonal antibody (D01P)