STEAP1 polyclonal antibody (A01)
  • STEAP1 polyclonal antibody (A01)

STEAP1 polyclonal antibody (A01)

Ref: AB-H00026872-A01
STEAP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant STEAP1.
Información adicional
Size 50 uL
Gene Name STEAP1
Gene Alias MGC19484|PRSS24|STEAP
Gene Description six transmembrane epithelial antigen of the prostate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STEAP1 (AAH11802, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26872

Enviar un mensaje


STEAP1 polyclonal antibody (A01)

STEAP1 polyclonal antibody (A01)