HAVCR1 monoclonal antibody (M02J), clone 2B9
  • HAVCR1 monoclonal antibody (M02J), clone 2B9

HAVCR1 monoclonal antibody (M02J), clone 2B9

Ref: AB-H00026762-M02J
HAVCR1 monoclonal antibody (M02J), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HAVCR1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name HAVCR1
Gene Alias HAVCR|HAVCR-1|KIM-1|KIM1|TIM-1|TIM1|TIMD1
Gene Description hepatitis A virus cellular receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq KVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HAVCR1 (NP_036338, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26762
Clone Number 2B9
Iso type IgG2a Kappa

Enviar un mensaje


HAVCR1 monoclonal antibody (M02J), clone 2B9

HAVCR1 monoclonal antibody (M02J), clone 2B9