NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)
  • NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)

NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00026747-B02P
NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NUFIP1 protein.
Información adicional
Size 50 ug
Gene Name NUFIP1
Gene Alias NUFIP|bA540M5.1
Gene Description nuclear fragile X mental retardation protein interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUFIP1 (AAH17745.1, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26747

Enviar un mensaje


NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)

NUFIP1 purified MaxPab mouse polyclonal antibody (B02P)