ELP4 MaxPab mouse polyclonal antibody (B01P)
  • ELP4 MaxPab mouse polyclonal antibody (B01P)

ELP4 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026610-B01P
ELP4 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ELP4 protein.
Información adicional
Size 50 ug
Gene Name ELP4
Gene Alias C11orf19|FLJ20498|PAX6NEB|PAXNEB|dJ68P15A.1
Gene Description elongation protein 4 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ELP4 (AAH12514.1, 1 a.a. ~ 535 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26610

Enviar un mensaje


ELP4 MaxPab mouse polyclonal antibody (B01P)

ELP4 MaxPab mouse polyclonal antibody (B01P)