ELP4 polyclonal antibody (A01)
  • ELP4 polyclonal antibody (A01)

ELP4 polyclonal antibody (A01)

Ref: AB-H00026610-A01
ELP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ELP4.
Información adicional
Size 50 uL
Gene Name ELP4
Gene Alias C11orf19|FLJ20498|PAX6NEB|PAXNEB|dJ68P15A.1
Gene Description elongation protein 4 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq YFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELP4 (NP_061913, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26610

Enviar un mensaje


ELP4 polyclonal antibody (A01)

ELP4 polyclonal antibody (A01)