CKAP2 polyclonal antibody (A01)
  • CKAP2 polyclonal antibody (A01)

CKAP2 polyclonal antibody (A01)

Ref: AB-H00026586-A01
CKAP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CKAP2.
Información adicional
Size 50 uL
Gene Name CKAP2
Gene Alias DKFZp686L1238|FLJ10749|LB1|TMAP|se20-10
Gene Description cytoskeleton associated protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CKAP2 (AAH10901.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26586

Enviar un mensaje


CKAP2 polyclonal antibody (A01)

CKAP2 polyclonal antibody (A01)