STK23 polyclonal antibody (A01)
  • STK23 polyclonal antibody (A01)

STK23 polyclonal antibody (A01)

Ref: AB-H00026576-A01
STK23 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STK23.
Información adicional
Size 50 uL
Gene Name SRPK3
Gene Alias MGC102944|MSSK1|STK23
Gene Description SFRS protein kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK23 (NP_055185, 434 a.a. ~ 533 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26576

Enviar un mensaje


STK23 polyclonal antibody (A01)

STK23 polyclonal antibody (A01)