TIMM8B monoclonal antibody (M15), clone 8E5
  • TIMM8B monoclonal antibody (M15), clone 8E5

TIMM8B monoclonal antibody (M15), clone 8E5

Ref: AB-H00026521-M15
TIMM8B monoclonal antibody (M15), clone 8E5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TIMM8B.
Información adicional
Size 100 ug
Gene Name TIMM8B
Gene Alias DDP2|FLJ21744|MGC102866|MGC117373|TIM8B
Gene Description translocase of inner mitochondrial membrane 8 homolog B (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26521
Clone Number 8E5
Iso type IgG2a Kappa

Enviar un mensaje


TIMM8B monoclonal antibody (M15), clone 8E5

TIMM8B monoclonal antibody (M15), clone 8E5