TIMM8B monoclonal antibody (M03), clone 3C8
  • TIMM8B monoclonal antibody (M03), clone 3C8

TIMM8B monoclonal antibody (M03), clone 3C8

Ref: AB-H00026521-M03
TIMM8B monoclonal antibody (M03), clone 3C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TIMM8B.
Información adicional
Size 100 ug
Gene Name TIMM8B
Gene Alias DDP2|FLJ21744|MGC102866|MGC117373|TIM8B
Gene Description translocase of inner mitochondrial membrane 8 homolog B (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TIMM8B (NP_036591, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26521
Clone Number 3C8
Iso type IgG1 Kappa

Enviar un mensaje


TIMM8B monoclonal antibody (M03), clone 3C8

TIMM8B monoclonal antibody (M03), clone 3C8