FER1L3 polyclonal antibody (A01)
  • FER1L3 polyclonal antibody (A01)

FER1L3 polyclonal antibody (A01)

Ref: AB-H00026509-A01
FER1L3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FER1L3.
Información adicional
Size 50 uL
Gene Name MYOF
Gene Alias FER1L3|FLJ36571|FLJ90777
Gene Description myoferlin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FER1L3 (NP_038479, 655 a.a. ~ 754 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26509

Enviar un mensaje


FER1L3 polyclonal antibody (A01)

FER1L3 polyclonal antibody (A01)