HEYL monoclonal antibody (M12), clone 3D3
  • HEYL monoclonal antibody (M12), clone 3D3

HEYL monoclonal antibody (M12), clone 3D3

Ref: AB-H00026508-M12
HEYL monoclonal antibody (M12), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HEYL.
Información adicional
Size 100 ug
Gene Name HEYL
Gene Alias HRT3|MGC12623|bHLHb33
Gene Description hairy/enhancer-of-split related with YRPW motif-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26508
Clone Number 3D3
Iso type IgG2b Kappa

Enviar un mensaje


HEYL monoclonal antibody (M12), clone 3D3

HEYL monoclonal antibody (M12), clone 3D3