OR8B8 purified MaxPab mouse polyclonal antibody (B01P)
  • OR8B8 purified MaxPab mouse polyclonal antibody (B01P)

OR8B8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026493-B01P
OR8B8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OR8B8 protein.
Información adicional
Size 50 ug
Gene Name OR8B8
Gene Alias TPCR85
Gene Description olfactory receptor, family 8, subfamily B, member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAAENSSFVTQFILAGLTDQPGVQIPLFFLFLGFYVVTVVGNLGLITLIRLNSHLHTPMYFFLYNLSFIDFCYSSVITPKMLMSFVLKKNSISYAGCMTQLFFFLFFVVSESFILSAMAYDRYVAICNPLLYMVTMSPQVCFLLLLGVYGMGFAGAMAHTACMMGVTFCANNLVNHYMCDILPLLECACTSTYVNELVVFVVVGIDIGVPTVTIFISYALILSSIFHIDSTEGRSKAFSTCSSHIIAVSLFFGSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OR8B8 (NP_036510.1, 1 a.a. ~ 311 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26493

Enviar un mensaje


OR8B8 purified MaxPab mouse polyclonal antibody (B01P)

OR8B8 purified MaxPab mouse polyclonal antibody (B01P)