LHX6 monoclonal antibody (M05), clone 3E8
  • LHX6 monoclonal antibody (M05), clone 3E8

LHX6 monoclonal antibody (M05), clone 3E8

Ref: AB-H00026468-M05
LHX6 monoclonal antibody (M05), clone 3E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX6.
Información adicional
Size 100 ug
Gene Name LHX6
Gene Alias LHX6.1|MGC119542|MGC119544|MGC119545
Gene Description LIM homeobox 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26468
Clone Number 3E8
Iso type IgG2b Kappa

Enviar un mensaje


LHX6 monoclonal antibody (M05), clone 3E8

LHX6 monoclonal antibody (M05), clone 3E8