GNL3 monoclonal antibody (M09), clone 4B10
  • GNL3 monoclonal antibody (M09), clone 4B10

GNL3 monoclonal antibody (M09), clone 4B10

Ref: AB-H00026354-M09
GNL3 monoclonal antibody (M09), clone 4B10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GNL3.
Información adicional
Size 100 ug
Gene Name GNL3
Gene Alias C77032|E2IG3|MGC800|NS
Gene Description guanine nucleotide binding protein-like 3 (nucleolar)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQKGGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GNL3 (AAH01024.1, 328 a.a. ~ 427 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26354
Clone Number 4B10
Iso type IgG2a Kappa

Enviar un mensaje


GNL3 monoclonal antibody (M09), clone 4B10

GNL3 monoclonal antibody (M09), clone 4B10