EHF purified MaxPab rabbit polyclonal antibody (D01P)
  • EHF purified MaxPab rabbit polyclonal antibody (D01P)

EHF purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00026298-D01P
EHF purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EHF protein.
Información adicional
Size 100 ug
Gene Name EHF
Gene Alias ESE3|ESEJ
Gene Description ets homologous factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EHF (NP_036285.2, 1 a.a. ~ 300 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26298

Enviar un mensaje


EHF purified MaxPab rabbit polyclonal antibody (D01P)

EHF purified MaxPab rabbit polyclonal antibody (D01P)