FGF21 monoclonal antibody (M06A), clone 3E20
  • FGF21 monoclonal antibody (M06A), clone 3E20

FGF21 monoclonal antibody (M06A), clone 3E20

Ref: AB-H00026291-M06A
FGF21 monoclonal antibody (M06A), clone 3E20

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant FGF21.
Información adicional
Size 200 uL
Gene Name FGF21
Gene Alias -
Gene Description fibroblast growth factor 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 26291
Clone Number 3E20
Iso type IgM Kappa

Enviar un mensaje


FGF21 monoclonal antibody (M06A), clone 3E20

FGF21 monoclonal antibody (M06A), clone 3E20