Ver mas grande
FGF21 monoclonal antibody (M03), clone 3G10
AB-H00026291-M03
Producto nuevo
FGF21 monoclonal antibody (M03), clone 3G10
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | FGF21 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 21 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | FGF21 (AAH18404, 30 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 26291 |
| Clone Number | 3G10 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant FGF21.