FBXO3 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXO3 purified MaxPab mouse polyclonal antibody (B01P)

FBXO3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026273-B01P
FBXO3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXO3 protein.
Información adicional
Size 50 ug
Gene Name FBXO3
Gene Alias DKFZp564B092|FBA|FBX3
Gene Description F-box protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO3 (NP_036307.2, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26273

Enviar un mensaje


FBXO3 purified MaxPab mouse polyclonal antibody (B01P)

FBXO3 purified MaxPab mouse polyclonal antibody (B01P)