FBXO4 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXO4 purified MaxPab mouse polyclonal antibody (B01P)

FBXO4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026272-B01P
FBXO4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXO4 protein.
Información adicional
Size 50 ug
Gene Name FBXO4
Gene Alias DKFZp547N213|FBX4|FLJ10141
Gene Description F-box protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO4 (NP_036308.1, 1 a.a. ~ 387 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26272

Enviar un mensaje


FBXO4 purified MaxPab mouse polyclonal antibody (B01P)

FBXO4 purified MaxPab mouse polyclonal antibody (B01P)