FBXO5 monoclonal antibody (M01), clone 5H7
  • FBXO5 monoclonal antibody (M01), clone 5H7

FBXO5 monoclonal antibody (M01), clone 5H7

Ref: AB-H00026271-M01
FBXO5 monoclonal antibody (M01), clone 5H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FBXO5.
Información adicional
Size 50 ug
Gene Name FBXO5
Gene Alias EMI1|FBX5|Fbxo31
Gene Description F-box protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO5 (NP_036309, 358 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26271
Clone Number 5H7
Iso type IgG1 Kappa

Enviar un mensaje


FBXO5 monoclonal antibody (M01), clone 5H7

FBXO5 monoclonal antibody (M01), clone 5H7