FBXO6 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXO6 purified MaxPab mouse polyclonal antibody (B01P)

FBXO6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026270-B01P
FBXO6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXO6 protein.
Información adicional
Size 50 ug
Gene Name FBXO6
Gene Alias FBG2|FBS2|FBX6|Fbx6b
Gene Description F-box protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXO6 (NP_060908.1, 1 a.a. ~ 293 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26270

Enviar un mensaje


FBXO6 purified MaxPab mouse polyclonal antibody (B01P)

FBXO6 purified MaxPab mouse polyclonal antibody (B01P)