FBXO10 polyclonal antibody (A01)
  • FBXO10 polyclonal antibody (A01)

FBXO10 polyclonal antibody (A01)

Ref: AB-H00026267-A01
FBXO10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO10.
Información adicional
Size 50 uL
Gene Name FBXO10
Gene Alias FBX10|FLJ41992|MGC149840
Gene Description F-box protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq RAKALVQENIIFQGKTSKTIFQQISNNRECIMQNNKFLVFKKKSDTWRLVNPPARPHLENSLRRPSAAHNGQKVTAMATRITARVEGGYHSNRSVFCTIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO10 (XP_291314, 863 a.a. ~ 962 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26267

Enviar un mensaje


FBXO10 polyclonal antibody (A01)

FBXO10 polyclonal antibody (A01)