TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)
  • TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)

TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026262-B01P
TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TSPAN17 protein.
Información adicional
Size 50 ug
Gene Name TSPAN17
Gene Alias FBX23|FBXO23|MGC14859|MGC71255|TM4SF17
Gene Description tetraspanin 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGKHQHFQEPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIALLQIFGICL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSPAN17 (NP_569732.2, 1 a.a. ~ 329 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26262

Enviar un mensaje


TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)

TSPAN17 purified MaxPab mouse polyclonal antibody (B01P)