FBXO24 polyclonal antibody (A01) Ver mas grande

FBXO24 polyclonal antibody (A01)

AB-H00026261-A01

Producto nuevo

FBXO24 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name FBXO24
Gene Alias DKFZp434I1122|FBX24
Gene Description F-box protein 24
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO24 (NP_277041, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26261

Más información

Mouse polyclonal antibody raised against a partial recombinant FBXO24.

Consulta sobre un producto

FBXO24 polyclonal antibody (A01)

FBXO24 polyclonal antibody (A01)