FBXO24 polyclonal antibody (A01)
  • FBXO24 polyclonal antibody (A01)

FBXO24 polyclonal antibody (A01)

Ref: AB-H00026261-A01
FBXO24 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXO24.
Información adicional
Size 50 uL
Gene Name FBXO24
Gene Alias DKFZp434I1122|FBX24
Gene Description F-box protein 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXO24 (NP_277041, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26261

Enviar un mensaje


FBXO24 polyclonal antibody (A01)

FBXO24 polyclonal antibody (A01)