FBXL5 polyclonal antibody (A01)
  • FBXL5 polyclonal antibody (A01)

FBXL5 polyclonal antibody (A01)

Ref: AB-H00026234-A01
FBXL5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FBXL5.
Información adicional
Size 50 uL
Gene Name FBXL5
Gene Alias FBL4|FBL5|FLR1
Gene Description F-box and leucine-rich repeat protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FBXL5 (NP_036293, 584 a.a. ~ 691 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 26234

Enviar un mensaje


FBXL5 polyclonal antibody (A01)

FBXL5 polyclonal antibody (A01)