FBXL6 purified MaxPab mouse polyclonal antibody (B01P)
  • FBXL6 purified MaxPab mouse polyclonal antibody (B01P)

FBXL6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026233-B01P
FBXL6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FBXL6 protein.
Información adicional
Size 50 ug
Gene Name FBXL6
Gene Alias FBL6|FBL6A|PP14630
Gene Description F-box and leucine-rich repeat protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBXL6 (NP_036294.1, 1 a.a. ~ 539 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26233

Enviar un mensaje


FBXL6 purified MaxPab mouse polyclonal antibody (B01P)

FBXL6 purified MaxPab mouse polyclonal antibody (B01P)