LRRC29 purified MaxPab mouse polyclonal antibody (B01P)
  • LRRC29 purified MaxPab mouse polyclonal antibody (B01P)

LRRC29 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00026231-B01P
LRRC29 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LRRC29 protein.
Información adicional
Size 50 ug
Gene Name LRRC29
Gene Alias FBL9|FBXL9
Gene Description leucine rich repeat containing 29
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LRRC29 (NP_001004055.1, 1 a.a. ~ 223 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26231

Enviar un mensaje


LRRC29 purified MaxPab mouse polyclonal antibody (B01P)

LRRC29 purified MaxPab mouse polyclonal antibody (B01P)