SHFM3P1 monoclonal antibody (M15), clone 2C5
  • SHFM3P1 monoclonal antibody (M15), clone 2C5

SHFM3P1 monoclonal antibody (M15), clone 2C5

Ref: AB-H00026226-M15
SHFM3P1 monoclonal antibody (M15), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SHFM3P1.
Información adicional
Size 100 ug
Gene Name FBXW4P1
Gene Alias FBW3|FBXW3|SHFM3P1
Gene Description F-box and WD repeat domain containing 4 pseudogene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGILLKWRCSQMPWMQLEDDALYISQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SHFM3P1 (AAF04527, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26226
Clone Number 2C5
Iso type IgG2a Kappa

Enviar un mensaje


SHFM3P1 monoclonal antibody (M15), clone 2C5

SHFM3P1 monoclonal antibody (M15), clone 2C5