SHFM3P1 monoclonal antibody (M08), clone 3F1
  • SHFM3P1 monoclonal antibody (M08), clone 3F1

SHFM3P1 monoclonal antibody (M08), clone 3F1

Ref: AB-H00026226-M08
SHFM3P1 monoclonal antibody (M08), clone 3F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SHFM3P1.
Información adicional
Size 100 ug
Gene Name FBXW4P1
Gene Alias FBW3|FBXW3|SHFM3P1
Gene Description F-box and WD repeat domain containing 4 pseudogene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EVLLLHMCSYLDMRALGRLAQVYRWLWHFTNCDLLRRQIAWASLNSGFTRLGTNLMTSVPVKVSQNWIVGCCREGILLKWRCSQMPWMQLEDDALYISQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SHFM3P1 (AAF04527, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 26226
Clone Number 3F1
Iso type IgG2a Kappa

Enviar un mensaje


SHFM3P1 monoclonal antibody (M08), clone 3F1

SHFM3P1 monoclonal antibody (M08), clone 3F1